PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK26393.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family WRKY
Protein Properties Length: 176aa    MW: 19488.5 Da    PI: 6.0152
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK26393.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY97.86.8e-31115173159
                 ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 ldDg++WrKYG+K+vk+s++pr+YY+C+  gC+vkk++er+ +dp++v++ Yeg+Hnh+
  KFK26393.1 115 LDDGFKWRKYGKKMVKNSPNPRNYYKCSADGCTVKKRIERDGDDPSFVITSYEGTHNHS 173
                 59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.3E-32101174IPR003657WRKY domain
SuperFamilySSF1182903.79E-27108173IPR003657WRKY domain
PROSITE profilePS5081129.551110175IPR003657WRKY domain
SMARTSM007743.9E-34115174IPR003657WRKY domain
PfamPF031065.5E-24116172IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MNDAEENLGR SFSDDTHSGF ELSELCLSDE WMDDDLVSAV SAMNGMNHSY GYQTSDAAAV  60
LFSGSSSSLI YPESSCTNVS VAATAPASAV NQNKKEKKKV KERVAFKTRS EIDVLDDGFK  120
WRKYGKKMVK NSPNPRNYYK CSADGCTVKK RIERDGDDPS FVITSYEGTH NHSSMH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-27105172774Probable WRKY transcription factor 4
2lex_A4e-27105172774Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00531DAPTransfer from AT5G26170Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_197989.26e-90putative WRKY transcription factor 50
SwissprotQ8VWQ57e-92WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBLA0A087G9411e-130A0A087G941_ARAAL; Uncharacterized protein
STRINGAT5G26170.12e-89(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61212747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.15e-85WRKY DNA-binding protein 50